PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G007200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 358aa    MW: 39358.9 Da    PI: 5.4375
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G007200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-1755101148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg+W++eE e+l++ v  + +++W++Iar ++ gR++kqc++rw  yl
  Sevir.1G007200.1.p  55 RGAWSQEENEILIQMVDAHSSKDWSSIARAVP-GRSRKQCRDRWTHYL 101
                         89******************************.***********9886 PP

2Myb_DNA-binding40.66.1e-13108148244
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                         ++W+++E+  l++a+k +G++ W   a+ ++ gRt+k +k++w
  Sevir.1G007200.1.p 108 MPWSEQEEIDLIRAHKIHGNK-WCELAKFFP-GRTGKAIKNYW 148
                         68*******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.33550105IPR017930Myb domain
SuperFamilySSF466898.44E-2853148IPR009057Homeodomain-like
SMARTSM007172.2E-1554103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2256108IPR009057Homeodomain-like
CDDcd001671.19E-1357101No hitNo description
PfamPF139216.3E-1758118No hitNo description
SMARTSM007176.4E-12106154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-19109156IPR009057Homeodomain-like
PROSITE profilePS5129414.541109156IPR017930Myb domain
CDDcd001672.02E-11109148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MVRSAGGVHR RGTSTKPTSC SREIDWIAEE HDEPLQASEY FDDEEPEGTV SFKRRGAWSQ  60
EENEILIQMV DAHSSKDWSS IARAVPGRSR KQCRDRWTHY LDPAVNQMPW SEQEEIDLIR  120
AHKIHGNKWC ELAKFFPGRT GKAIKNYWTG AMKKKIKSNL GSGSPEQLSP CPNDSLIPVG  180
RDSTATSSQD SSNNIPISSA DLPVRLKSKH GLTEACRNAC TLKEKGPDSI HDEGSIPHSV  240
NVSQMVDGRT VGSSLHILTE EKLVSPLSSV DEKVSCVAAN SPKPLKEEES TNFLEIPPAL  300
SFQSSNVHSD AICSSADPES RQLHLASIAD LLDMSYCESL MVIAPDSTND EDFKLGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28551587110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952183.11e-112PREDICTED: myb-related protein 3R-1-like
TrEMBLK3YUP10.0K3YUP1_SETIT; Uncharacterized protein
STRINGSi017987m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16796912
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-40myb domain protein 3r-4